PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g014550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 1161aa    MW: 128464 Da    PI: 6.9606
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g014550.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.6e-23127228199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +
  Csa08g014550.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR--DGK 218
                     99*****************************98888885.9************************************************5..467 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     ++l+++++r+
  Csa08g014550.1 219 AQLLLGIRRA 228
                     8889999997 PP

2Auxin_resp117.51.1e-38253335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Csa08g014550.1 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 335
                     799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-19126227No hitNo description
PROSITE profilePS5086312.125127229IPR003340B3 DNA binding domain
SMARTSM010199.7E-23127229IPR003340B3 DNA binding domain
PfamPF023623.1E-21127228IPR003340B3 DNA binding domain
PfamPF065071.0E-33253335IPR010525Auxin response factor
PfamPF023091.8E-910311119IPR033389AUX/IAA domain
PROSITE profilePS5174526.95610331126IPR000270PB1 domain
SuperFamilySSF542771.03E-810461111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1161 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDCIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFGGQPGM PDDETDMESA LKRAMPWLDN SSEMKDASST IFPGLSLVQW  420
MNMQQQNGQL PSAAAQPGFF PSMLSPSAAL HNNLGGTDDP SKLLSFQTPQ GGISSSNLQY  480
NKPNSQAPMS QLPQPPTTLS QQQQLQQLLH SSLNHQQQQS QSQQQQQQQL LQQQQQLQSQ  540
HHSNNNQSQS QQQQQLLQQQ QQQQQQQQQL VQQQHQQPLQ QQIQRTQSLQ SHSHPQQQPQ  600
QVQQHKSQQL QHPQNQHYNG QQTAQQHQAQ QHLQPQLVSG SMASSVITPP SSSLNQSFQQ  660
QPKQLQQAHH HLGASTSQSN VIETTKSSSN LMSVPPQETQ FPRQVEQQQP SGLKGQNQQT  720
LLQQKAHQAQ AQQIFQHSLL EQPHLQFQLL QRLQQQQQQQ FLSPQSQLPH HQLQSQQLQQ  780
LPALSQGHQF PSSCTNNGLS TLQPPQMLVN RPQEKQNPPV GGGVKAYSGI TDGGDAPSSS  840
TSPSTNNCQI SSSGFLNRSQ SGPAILMPDP AIDISGNLVQ DLYSKSDMRL KQELVGQQKS  900
KASLTDHHLE ASASGTSYGL DGGDNNRQQN FLAPTFGLDG DSRNSLLGGP NVDNGFVPDT  960
LLSRGYDSQK DLQNMLSNYG GVTNDIGTEM STSAVRTQSF GVPNVPAISN DLAVNDAGVL  1020
GGGLWPAQTQ RMRTYTKVQK RGSVGRSIDV NRYRGYDELR HDLARMFGIE GQLEDPQTSD  1080
WKLVYVDHEN DILLVGDDPW EEFVNCVQSI KILSSAEVQQ MSLDGNFAGV PVTNQACSGG  1140
DSGNAWRGHY DDNSATSFNR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1682135651388Auxin response factor 5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0421950.0AF042195.1 Arabidopsis thaliana auxin response factor 7 (ARF7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420922.10.0PREDICTED: auxin response factor 7 isoform X3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein